- Recombinant Narcissus mosaic virus Movement protein TGB2 (ORF3)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1012151
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 13,998 Da
- E Coli or Yeast
- Movement protein TGB2 (ORF3)
- 1-130
Sequence
MPGLTPPVNYEQVYKVLAIGFLLCASIYCLRSNHLPHVGDNIHSLPHGGNYADGTKRVQYFRPHSSTSTNHKYTALCAVLTLSLLIFAQTRLAAGNRITSVSICHHCSSQGSLSGGNHGRVSGHSELPTT